PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT02668
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 249aa    MW: 28439 Da    PI: 6.7801
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT02668genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed ll ++v+q G g+W+++a+  g++R++k+c++rw +yl
         EMT02668 17 KGPWTALEDRLLTEYVQQQGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 64
                     79********************************************97 PP

2Myb_DNA-binding52.11.5e-1670114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  +++++++lG++ W++Iar+++ gRt++++k++w+++
         EMT02668  70 RGKITADEETVILQLHAMLGNR-WSAIARCLP-GRTDNEIKNYWRTH 114
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7011264IPR017930Myb domain
SuperFamilySSF466892.77E-2915111IPR009057Homeodomain-like
SMARTSM007171.8E-131666IPR001005SANT/Myb domain
PfamPF002492.9E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-221871IPR009057Homeodomain-like
CDDcd001676.08E-101964No hitNo description
PROSITE profilePS5129422.94865119IPR017930Myb domain
SMARTSM007171.8E-1569117IPR001005SANT/Myb domain
PfamPF002492.7E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2372117IPR009057Homeodomain-like
CDDcd001673.95E-1174115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MAMDAMSSAV LQGAWRKGPW TALEDRLLTE YVQQQGEGSW NSVAKLTGLR RSGKSCRLRW  60
VNYLRPDLKR GKITADEETV ILQLHAMLGN RWSAIARCLP GRTDNEIKNY WRTHFKKARP  120
SRRARAQLLH QYQLQQQQQH RQYLHALHLL QQQQQEMQMQ LQENQQQQQQ QQQGMMMAQQ  180
SPPEEDQAVI TTVGNMNSMG TAECYCPCPA ASAVLDLPLP ADDEDALWDS LWRLVDGEDG  240
SSGGDSGEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271011720126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9604501e-177EU960450.1 Zea mays clone 224989 MYB305 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562106.11e-101PREDICTED: transcription factor WER-like
TrEMBLR7W0L60.0R7W0L6_AEGTA; Myb-related protein 305
STRINGMLOC_9927.21e-133(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-58myb domain protein 305